PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01509.1.p
Common NameEUGRSUZ_E01509, LOC104444411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GRAS
Protein Properties Length: 730aa    MW: 79875.8 Da    PI: 6.4419
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01509.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.21.6e-1003727282374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       v++L++++e +++g+ elaq +Larl+++ sp g+p+ R+a+y++eAL+  l+       ++ +p + s+ + + ++ a+k fsevsP+l+f+
  Eucgr.E01509.1.p 372 VDQLYKAVELIEAGNPELAQGILARLNHQLSPIGKPFIRAAFYVKEALQLLLQT------NSTNPLAFSPFSLIYKIGAYKSFSEVSPVLQFA 458
                       789**************************************************9......555666666666********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       ++t+Nqa lea+e+ +rvHi+ fd+++G+QW++L+q+La R++g+ sl+iT+++sp  +++ el  t+e+L++fA+el++ +ef+v+  ++l+
  Eucgr.E01509.1.p 459 NFTCNQAFLEALEEYDRVHILSFDVGYGGQWASLMQELALRNKGSRSLKITAFASPMIHDELELGLTQENLKHFANELNIYVEFEVVNIEALS 551
                       ***************************************************************************************888776 PP

              GRAS 188 dl.eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       +   +e L+++ gEa+aVnl ++ ++++      +s  ++vL+++k+lsPk+vv  ++ +d+ +++F +++++al+ ys+l++sl+a    + 
  Eucgr.E01509.1.p 552 SSsWPEPLNIRDGEAIAVNLPIASFSTH------PSILPSVLRFIKQLSPKIVVSLDRSCDRIDAPFPQHVVQALNSYSSLLESLDAL-NVNF 637
                       652699****************999887......334457*********************************************876.4567 PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       + ++k+Er +l++ i++++  ++++     e+  +Wr+ + ++GF+p+++s+++++qa++l+++++++g++ve++++slvl+W++++L+svSa
  Eucgr.E01509.1.p 638 DVMQKIERYFLQPGIEKIIRGRHRS----PEKTDSWRSLFLSSGFSPLAFSNFNESQAECLVQRTPVRGFHVEKRQHSLVLCWQRKELLSVSA 726
                       *******************998888....99************************************************************** PP

              GRAS 373 Wr 374
                       Wr
  Eucgr.E01509.1.p 727 WR 728
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.813345708IPR005202Transcription factor GRAS
PfamPF035145.4E-98372728IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MKATPLGVVL GFSAATDSSL KDHQHHRHHH QEEHQKWLST ETPSSKLGNF FVGSEKSSLL  60
DIRRSLSPQP SSTLSSSLNS SGCAGASTDT TGAAGAAAAA ASGNNTPRGG ASGKCGMGAE  120
DWEAVLPENG QEQSIMRMIM GDIEDPSVGL SKLLQGTGGS QELAFGAGFG ELDQGFSFEP  180
MTGSNLNSEA SLHDCGSDFP LGGSNVHGNN VRIPSVSNPI LFPGQRKPNS FSSSSANNAL  240
VPALPLGVFQ LQQDGSLDEK PMVFDPQAIV NQNQATYPQN PSFFVPLGHT QMQDHDLLSA  300
PPPKRQNSGP GGPNYSSSRT GLVNSGQDTF VRHQEQYHFH PQQFQTQRPV PAAMKQKMSD  360
ELPNHQVQQA IVDQLYKAVE LIEAGNPELA QGILARLNHQ LSPIGKPFIR AAFYVKEALQ  420
LLLQTNSTNP LAFSPFSLIY KIGAYKSFSE VSPVLQFANF TCNQAFLEAL EEYDRVHILS  480
FDVGYGGQWA SLMQELALRN KGSRSLKITA FASPMIHDEL ELGLTQENLK HFANELNIYV  540
EFEVVNIEAL SSSSWPEPLN IRDGEAIAVN LPIASFSTHP SILPSVLRFI KQLSPKIVVS  600
LDRSCDRIDA PFPQHVVQAL NSYSSLLESL DALNVNFDVM QKIERYFLQP GIEKIIRGRH  660
RSPEKTDSWR SLFLSSGFSP LAFSNFNESQ AECLVQRTPV RGFHVEKRQH SLVLCWQRKE  720
LLSVSAWRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3338472816375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01509.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056372.10.0PREDICTED: scarecrow-like protein 22
TrEMBLA0A059C3M90.0A0A059C3M9_EUCGR; Uncharacterized protein
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-141GRAS family protein